PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G005894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NF-YB
Protein Properties Length: 210aa    MW: 21746 Da    PI: 6.6791
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G005894.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.22.2e-5724119297
                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                           reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+++
  HL.SW.v1.0.G005894.1  24 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQRF 112
                           89*************************************************************************************** PP

                 NF-YB  91 relegek 97 
                           re+egek
  HL.SW.v1.0.G005894.1 113 REMEGEK 119
                           *****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-5419127IPR009072Histone-fold
SuperFamilySSF471133.26E-4026123IPR009072Histone-fold
PfamPF008081.3E-272993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-205775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-207694No hitNo description
PRINTSPR006151.1E-2095113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MADSDNDSGG HNTGANANNE LSPREQDRLL PIANVSRIMK KALPANAKIS KDAKETVQEC  60
VSEFISFITG EASDKCQREK RKTINGDDLL WAMTTLGFEE YVEPLKIYLQ RFREMEGEKG  120
GSAVAARDKD AVSGSVGNGG GYGDGGGGGG GGGGGGMYGS GMVMMSQQHQ GHVYGSGGFH  180
QMASNSGGGL GPKSGPGHLS PNSNYGRPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A5e-4821114194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B5e-4821114194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311587e-74KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523242.16e-94PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233101e-74NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0L9VBC01e-93A0A0L9VBC0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S6N11e-93A0A0S3S6N1_PHAAN; Uncharacterized protein
STRINGVIT_19s0015g00440.t011e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-75nuclear factor Y, subunit B3